![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aco030850.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 109aa MW: 11952.4 Da PI: 10.6897 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 64.4 | 2.2e-20 | 30 | 75 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+W++eEde l ++v+++G ++W++I++ ++ gR++k+c++rw +
Aco030850.1 30 KGPWSPEEDEALQRLVQKHGARNWSLISKSIP-GRSGKSCRLRWCNQ 75
79******************************.***********985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 26.003 | 25 | 80 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.59E-24 | 26 | 104 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.7E-17 | 29 | 78 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.3E-20 | 30 | 75 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-23 | 30 | 75 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.90E-16 | 32 | 74 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.3E-7 | 76 | 103 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MRNSSGGSSS SSSSSSKEGV GVGVVMDRIK GPWSPEEDEA LQRLVQKHGA RNWSLISKSI 60 PGRSGKSCRL RWCNQLSPQV EHRPFTPDED DAIVRAHRRF GNKALYTK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 4e-23 | 29 | 103 | 3 | 77 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 2e-22 | 29 | 103 | 57 | 131 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 2e-22 | 29 | 103 | 57 | 131 | MYB PROTO-ONCOGENE PROTEIN |
| 1mse_C | 4e-23 | 29 | 103 | 3 | 77 | C-Myb DNA-Binding Domain |
| 1msf_C | 4e-23 | 29 | 103 | 3 | 77 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM661458 | 1e-140 | KM661458.1 Ananas bracteatus clone 43635a microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020080712.1 | 2e-70 | transcription factor MYB44-like | ||||
| Swissprot | O23160 | 9e-44 | MYB73_ARATH; Transcription factor MYB73 | ||||
| TrEMBL | A0A199VPN2 | 3e-54 | A0A199VPN2_ANACO; Transcription factor MYB44 | ||||
| STRING | POPTR_0007s10490.1 | 6e-50 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP789 | 38 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37260.1 | 2e-45 | myb domain protein 73 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aco030850.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




