PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aco030916.1

Organism

Ananas comosus

Taxonomic ID

4615

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas

Family

NAC

Protein Properties

Length: 77aa MW: 8487.81 Da PI: 4.8575

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aco030916.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	60	8.1e-19	11	59	1	49
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 lppGfrFhPtd+el+ +yL++kv++ +++++++++vdiyk++Pw+Lp Aco030916.1 11 LPPGFRFHPTDQELIIYYLREKVASAVTPATSIVADVDIYKFNPWELPG 59 79**************************999************93 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.55E-19	6	61	IPR003441	NAC domain
PROSITE profile	PS51005	21.631	11	76	IPR003441	NAC domain
Pfam	PF02365	5.9E-9	12	54	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MDGIGFPGFR LPPGFRFHPT DQELIIYYLR EKVASAVTPA TSIVADVDIY KFNPWELPGA 60 APLLLFHQEN VATLLT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-13	11	61	15	64	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:24363315}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269\|PubMed:24363315, ECO:0000269\|PubMed:24659488}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020099751.1	5e-35	NAC transcription factor 56-like
Swissprot	Q84TD6	9e-20	NAC47_ARATH; NAC transcription factor 47
TrEMBL	A0A199VU68	1e-33	A0A199VU68_ANACO; NAC transcription factor NAM-B2
STRING	XP_008782049.1	7e-23	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP14845	11	21

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G04070.1	5e-14	NAC domain containing protein 47

Link Out ? help Back to Top
Phytozome	Aco030916.1

Publications ? help Back to Top
Hofmann NR A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air. Plant Cell, 2013. 25(12): p. 4771 [PMID:24363314] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]