PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ahy007174

Common Name

MYB25

Organism

Arachis hypogaea

Taxonomic ID

3818

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MYB_related

Protein Properties

Length: 75aa MW: 8472.24 Da PI: 4.322

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Ahy#S58452101	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.9	7.6e-11	27	67	3	45
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++eE+ l++ + ++ G + W++Ia +++ gRt++++ +w Ahy007174 27 KFSEEEEILIAMVYNLVGER-WSLIAGRIP-GRTAEEIEKYWT 67 68888888888888888888.*******.*********5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.113	20	74	IPR017930	Myb domain
SMART	SM00717	4.3E-7	24	72	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.01E-8	27	70	IPR009057	Homeodomain-like
Pfam	PF00249	4.8E-10	27	67	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.0E-13	28	68	IPR009057	Homeodomain-like
CDD	cd00167	9.50E-8	30	66	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MGDADRSSSH DVSPDSTEQT NQASKIKFSE EEEILIAMVY NLVGERWSLI AGRIPGRTAE 60 EIEKYWTSRY SSTSE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:12356720, ECO:0000269\|PubMed:16291794, ECO:0000269\|PubMed:19513241, ECO:0000269\|PubMed:9262483}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16176989, ECO:0000269\|PubMed:16207757, ECO:0000269\|PubMed:17450124, ECO:0000269\|PubMed:19513241}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025687370.1	1e-48	transcription factor CPC
Swissprot	O22059	6e-16	CPC_ARATH; Transcription factor CPC
TrEMBL	V5T7X7	3e-47	V5T7X7_ARAHY; Putative MYB-related protein 25
STRING	GLYMA12G10790.1	1e-31	(Glycine max)
STRING	XP_007132566.1	2e-31	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46410.1	3e-18	MYB_related family protein

Publications ? help Back to Top
Chen N, et al. Identification of 30 MYB transcription factor genes and analysis of their expression during abiotic stress in peanut (Arachis hypogaea L.). Gene, 2014. 533(1): p. 332-45 [PMID:24013078] Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Tominaga-Wada R,Wada T The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Kurata T,Wada T Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] Tominaga-Wada R,Kurata T,Wada T Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Tominaga-Wada R,Wada T Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]