![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ahy008129 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 92aa MW: 10867.3 Da PI: 6.6841 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 42.2 | 1.5e-13 | 37 | 86 | 4 | 55 |
HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
HLH 4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
+hn+ Er RR++iN ++ Lr++lP a + kK+s ++ ++ +YI +Lq
Ahy008129 37 NHNASERHRRKKINALYSSLRSILPVA--DQTKKMSIPATISRVLKYIPELQ 86
8*************************6..48888****************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47459 | 2.75E-15 | 33 | 92 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 13.624 | 33 | 85 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 4.6E-13 | 34 | 90 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| CDD | cd00083 | 4.57E-10 | 34 | 90 | No hit | No description |
| Pfam | PF00010 | 6.3E-11 | 37 | 86 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SMART | SM00353 | 1.5E-10 | 39 | 91 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MEWPLELEEE ELSHSHHEYF NSEEYPLLSS SMAKKFNHNA SERHRRKKIN ALYSSLRSIL 60 PVADQTKKMS IPATISRVLK YIPELQQQVE EL |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by OBP3, auxin and salicylic acid (SA). Repressed by jasmonic acid (JA), UV LIGHT, and heat treatments. Up regulated by iron deficiency in roots and leaves, as well as by nickel, high zinc or high copper treatments. Repressed by high iron, low copper and low zinc treatments. {ECO:0000269|PubMed:12679534, ECO:0000269|PubMed:12887587, ECO:0000269|PubMed:17516080}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025604301.1 | 3e-60 | transcription factor bHLH100 | ||||
| Swissprot | Q9M1K1 | 1e-24 | ORG2_ARATH; Transcription factor ORG2 | ||||
| TrEMBL | A0A445CLU9 | 8e-59 | A0A445CLU9_ARAHY; Uncharacterized protein | ||||
| STRING | VIT_13s0047g00450.t01 | 1e-26 | (Vitis vinifera) | ||||
| STRING | GLYMA19G31351.1 | 2e-27 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G56970.1 | 7e-27 | bHLH family protein | ||||




