| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | B3 | 77.5 | 1.4e-24 | 151 | 252 | 1 | 99 |
EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
B3 1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
f+k+lt sd++++g +++ +++a+e+ + k++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F + +++el+v
Ahy011439 151 FCKTLTASDTSTHGGFSVLRRHADEClppldmS-KQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRV 247
99*****************************63.4445569************************************************..449999*** PP
EEE-S CS
B3 95 kvfrk 99
+v+r+
Ahy011439 248 GVRRA 252
**996 PP
|
| 2 | Auxin_resp | 114.8 | 7.6e-38 | 277 | 359 | 1 | 83 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83
a+ha+ t+++F+v+Y+Pr+s++eF+v++++++++lk+++++G Rfkm+fe+e+++e+r++Gt+vg++d+d+ rWp+SkWrsLk
Ahy011439 277 AWHAILTGTMFTVYYKPRTSPAEFIVPYDQYMESLKNNYTIGLRFKMRFEGEEAPEQRFTGTIVGIEDADSKRWPESKWRSLK 359
79*******************************************************************************96 PP
|
| Publications
? help Back to Top |
- Tomato Genome Consortium
The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] - Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula). PLoS ONE, 2012. 7(8): p. e42839 [PMID:22916167] - Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors. Mol. Gen. Mikrobiol. Virusol., 2013. [PMID:24003511] - Li C, et al.
Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis. PLoS ONE, 2014. 9(4): p. e94830 [PMID:24756087] - Lyons R, et al.
Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana. PLoS ONE, 2015. 10(4): p. e0121902 [PMID:25849296] - Roodbarkelari F,Du F,Truernit E,Laux T
ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response. BMC Biol., 2015. 13: p. 74 [PMID:26358077] - Meng LS,Wang ZB,Yao SQ,Liu A
The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis. J. Cell. Sci., 2015. 128(21): p. 3922-32 [PMID:26395398] - Breitel DA, et al.
AUXIN RESPONSE FACTOR 2 Intersects Hormonal Signals in the Regulation of Tomato Fruit Ripening. PLoS Genet., 2016. 12(3): p. e1005903 [PMID:26959229] - Zhao S,Zhang ML,Ma TL,Wang Y
Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress. Plant Cell, 2016. 28(12): p. 3005-3019 [PMID:27895227] - Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis . J Integr Plant Biol, 2017. 59(1): p. 30-43 [PMID:28074634] - Wójcikowska B,Gaj MD
Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787] - Sanz-Fernández M, et al.
Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] - Zhang M,Hu X,Zhu M,Xu M,Wang L
Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis. Sci Rep, 2017. 7(1): p. 1395 [PMID:28469131] - Guan C, et al.
Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086] - Liu Z, et al.
ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis. Plant Cell Physiol., 2018. 59(1): p. 179-189 [PMID:29145642] - Sarkar Das S, et al.
Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination. Sci Rep, 2018. 8(1): p. 1233 [PMID:29352229]
|