![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ahy012104 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 170aa MW: 19770.2 Da PI: 10.2335 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 76.4 | 2.1e-24 | 2 | 51 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+ie + rq tfskR+ gi+KKA+ELS+LCda+ a+i+fs++gkl++++s
Ahy012104 2 KIEKNASRQATFSKRKRGIFKKAKELSTLCDADLALIVFSPSGKLFDFAS 51
699999*****************************************986 PP
| |||||||
| 2 | K-box | 36.4 | 2.2e-13 | 70 | 161 | 9 | 97 |
K-box 9 leeakaeslqqelakLkkeienLq...reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97
+++++ + q e + + ++L +Rhl Ge+L+ +++ eLq+Le+ L k+l ++ + K+e l+ i e++k+ ++ ++n++L+++
Ahy012104 70 SQDQQSHEFQLEKDTYYLKCKELTdktIGLRHLNGEELQGMKIHELQKLEKVLGKGLARVSKEKDERNLKDIIEMKKRGLQMVQDNHRLKQM 161
455566666666666666666666544567***********************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 8.3E-24 | 1 | 52 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 23.829 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.9E-24 | 2 | 49 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-26 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-14 | 15 | 30 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-14 | 30 | 51 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.2E-9 | 76 | 161 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 8.257 | 78 | 168 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
XKIEKNASRQ ATFSKRKRGI FKKAKELSTL CDADLALIVF SPSGKLFDFA SSSVQEVIER 60 YHMQTSIYRS QDQQSHEFQL EKDTYYLKCK ELTDKTIGLR HLNGEELQGM KIHELQKLEK 120 VLGKGLARVS KEKDERNLKD IIEMKKRGLQ MVQDNHRLKQ MRSQTNSQGX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1egw_A | 3e-14 | 8 | 61 | 15 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_B | 3e-14 | 8 | 61 | 15 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_C | 3e-14 | 8 | 61 | 15 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_D | 3e-14 | 8 | 61 | 15 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 3kov_A | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_A | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 3e-14 | 8 | 61 | 15 | 68 | Myocyte-specific enhancer factor 2A |
| 6bz1_A | 4e-14 | 8 | 61 | 16 | 69 | MEF2 CHIMERA |
| 6bz1_B | 4e-14 | 8 | 61 | 16 | 69 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025685925.1 | 1e-120 | MADS-box protein SVP isoform X1 | ||||
| Refseq | XP_025685927.1 | 1e-120 | MADS-box protein SVP isoform X2 | ||||
| Refseq | XP_025685928.1 | 1e-120 | MADS-box protein SVP isoform X2 | ||||
| Swissprot | Q9FVC1 | 2e-49 | SVP_ARATH; MADS-box protein SVP | ||||
| TrEMBL | A0A445BAP6 | 1e-114 | A0A445BAP6_ARAHY; Uncharacterized protein | ||||
| STRING | A0A087GSF1 | 2e-48 | (Arabis alpina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 8e-52 | MIKC_MADS family protein | ||||




