PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy014891
Organism
Arachis hypogaea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 71aa    MW: 8239.98 Da    PI: 6.2327
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58467745PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM60.74.7e-191865250
        NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
               ppGfrFhP+deel+v+yL++++++++l++ ++i+e+d+yk++PwdLpkk
  Ahy014891 18 PPGFRFHPSDEELIVHYLQNRISSRPLPA-SIIAEIDLYKYNPWDLPKK 65
               9****************************.89**************954 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-211166IPR003441NAC domain
PROSITE profilePS5100521.7211771IPR003441NAC domain
PfamPF023655.2E-81860IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MEEGGGDQHA SNSSYTFPPG FRFHPSDEEL IVHYLQNRIS SRPLPASIIA EIDLYKYNPW  60
DLPKKAFVWR X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-18867665Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935729.11e-40NAC transcription factor 32-like
RefseqXP_016169387.11e-40NAC transcription factor 47-like
RefseqXP_025614024.11e-40NAC transcription factor 32
RefseqXP_025671148.11e-40NAC transcription factor 47
SwissprotQ52QH47e-22NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A444Y7V43e-39A0A444Y7V4_ARAHY; Uncharacterized protein
TrEMBLA0A445BW982e-39A0A445BW98_ARAHY; Uncharacterized protein
STRINGAES674492e-30(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.18e-23NAC domain containing protein 25
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  6. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]