![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ahy015367 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 128aa MW: 13917.7 Da PI: 4.7973 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177.2 | 1.6e-55 | 35 | 128 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
reqdrflPian+srimkk lPan+ki+kdak+t+qecvsefisf+tsea +kcq+ekrktingddllwa+atlGfedy+eplkvyl+++releg
Ahy015367 35 REQDRFLPIANISRIMKKGLPANGKIAKDAKDTMQECVSEFISFITSEACEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARFRELEG 128
89*****************************************************************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.7E-51 | 33 | 127 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.33E-39 | 37 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.0E-29 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.3E-20 | 68 | 86 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.3E-20 | 87 | 105 | No hit | No description |
| PRINTS | PR00615 | 1.3E-20 | 106 | 124 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MADAPTSPAN GSHESGGEQS PQESSSGGLC GAGAREQDRF LPIANISRIM KKGLPANGKI 60 AKDAKDTMQE CVSEFISFIT SEACEKCQKE KRKTINGDDL LWAMATLGFE DYIEPLKVYL 120 ARFRELEG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-46 | 35 | 125 | 3 | 93 | NF-YB |
| 4awl_B | 2e-46 | 35 | 125 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-46 | 35 | 125 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015941015.1 | 5e-92 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_025619810.1 | 5e-92 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_025619811.1 | 5e-92 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q8VYK4 | 8e-64 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A445BH33 | 1e-90 | A0A445BH33_ARAHY; Uncharacterized protein | ||||
| STRING | cassava4.1_017552m | 4e-73 | (Manihot esculenta) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 8e-64 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




