PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ahy020455

Organism

Arachis hypogaea

Taxonomic ID

3818

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

NAC

Protein Properties

Length: 150aa MW: 17713.4 Da PI: 10.0697

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Ahy#S59549959	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	181.8	1.7e-56	3	128	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrFhPtdeel+++yL +kv ++++++ ++i+evd++++ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++lv Ahy020455 3 LPPGFRFHPTDEELISHYLYNKVIDTNFSA-RAIAEVDLNRSEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKSLV 100 79************************99.89***********888999************************************.999 PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 g+kktLvfykgrapkgek+dWvmhe+rl Ahy020455 101 GMKKTLVFYKGRAPKGEKSDWVMHEFRL 128 **************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.41E-63	2	150	IPR003441	NAC domain
PROSITE profile	PS51005	58.414	3	150	IPR003441	NAC domain
Pfam	PF02365	1.7E-29	4	128	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MDLPPGFRFH PTDEELISHY LYNKVIDTNF SARAIAEVDL NRSEPWDLPW KAKMGEKEWY 60 FFCVRDRKYP TGLRTNRATE AGYWKATGKD KEIYRGKSLV GMKKTLVFYK GRAPKGEKSD 120 WVMHEFRLHG KFNPHNLPKS AKNEWVICRV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-53	1	150	15	162	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-53	1	150	15	162	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-53	1	150	15	162	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-53	1	150	15	162	NO APICAL MERISTEM PROTEIN
3swm_A	1e-53	1	150	18	165	NAC domain-containing protein 19
3swm_B	1e-53	1	150	18	165	NAC domain-containing protein 19
3swm_C	1e-53	1	150	18	165	NAC domain-containing protein 19
3swm_D	1e-53	1	150	18	165	NAC domain-containing protein 19
3swp_A	1e-53	1	150	18	165	NAC domain-containing protein 19
3swp_B	1e-53	1	150	18	165	NAC domain-containing protein 19
3swp_C	1e-53	1	150	18	165	NAC domain-containing protein 19
3swp_D	1e-53	1	150	18	165	NAC domain-containing protein 19
4dul_A	1e-53	1	150	15	162	NAC domain-containing protein 19
4dul_B	1e-53	1	150	15	162	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269\|PubMed:27021284}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the microRNA miR164. {ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:17098808}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015937929.1	1e-111	NAC domain-containing protein 100
Refseq	XP_025616193.1	1e-111	NAC domain-containing protein 100
Swissprot	Q9FLJ2	1e-99	NC100_ARATH; NAC domain-containing protein 100
TrEMBL	A0A445C2C6	1e-109	A0A445C2C6_ARAHY; Uncharacterized protein
STRING	GLYMA06G21020.1	1e-102	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G61430.1	1e-102	NAC domain containing protein 100

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]