![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ahy022186 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 96aa MW: 10984.1 Da PI: 9.358 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 117.3 | 6.2e-37 | 13 | 70 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
+e+ ++cprCds+ntkfCy+nnysls PryfCkaC+ryWt GG+lrn+PvGgg+r ++
Ahy022186 13 EEEGVNCPRCDSSNTKFCYFNNYSLSSPRYFCKACKRYWTIGGTLRNIPVGGGARARR 70
57899**************************************************876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 5.0E-21 | 16 | 67 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.6E-31 | 16 | 69 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 26.86 | 17 | 71 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 19 | 55 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MERAEEQQQK QREEEGVNCP RCDSSNTKFC YFNNYSLSSP RYFCKACKRY WTIGGTLRNI 60 PVGGGARARR LNHPNTTPSR SSLNQINNNS DVNHPS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020968478.1 | 7e-43 | dof zinc finger protein DOF1.4 isoform X1 | ||||
| Swissprot | Q43385 | 2e-29 | DOF37_ARATH; Dof zinc finger protein DOF3.7 | ||||
| TrEMBL | A0A445BBJ8 | 2e-61 | A0A445BBJ8_ARAHY; Uncharacterized protein | ||||
| STRING | XP_008439843.1 | 3e-29 | (Cucumis melo) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G61850.3 | 1e-28 | Dof family protein | ||||




