PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aqcoe0011s0002.1.p

Organism

Aquilegia coerulea

Taxonomic ID

218851

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia

Family

MYB_related

Protein Properties

Length: 75aa MW: 8488.95 Da PI: 9.9679

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aqcoe0011s0002.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	29.4	1.8e-09	6	47	4	47
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT+eE+ ++ ++++ G + W I++ + ++R + q+ ++ qky Aqcoe0011s0002.1.p 6 WTEEEHRTFLAGIAKQG-D-WIGISKNFVTTRIPTQVANHAQKY 47 ***************.6.*********************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.433	1	52	IPR017930	Myb domain
SuperFamily	SSF46689	1.05E-10	3	51	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.5E-10	4	51	IPR006447	Myb domain, plants
Pfam	PF00249	9.9E-8	6	47	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.7E-8	6	47	IPR009057	Homeodomain-like
CDD	cd00167	4.70E-5	6	48	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MQGFLWTEEE HRTFLAGIAK QGDWIGISKN FVTTRIPTQV ANHAQKYFLR QIVSTLKLKI 60 EPHGIFAVFC SIII*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020248378.1	1e-21	probable transcription factor At5g61620
Swissprot	Q9LVS0	3e-19	KUA1_ARATH; Transcription factor KUA1
TrEMBL	A0A2G5C4B7	1e-47	A0A2G5C4B7_AQUCA; Uncharacterized protein
STRING	Aquca_097_00006.1	2e-48	(Aquilegia coerulea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G56840.1	8e-22	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Aqcoe0011s0002.1.p

Publications ? help Back to Top
Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]