![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aqcoe1G074300.6.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 100aa MW: 11183.9 Da PI: 10.9169 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 47.5 | 6.9e-15 | 14 | 76 | 72 | 134 |
YABBY 72 leelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfik 134
l++++++++ ++s++ ++s+ t+ ++++ +++e++e +r+ p+ PPekrqrvPsaynrfik
Aqcoe1G074300.6.p 14 LQNHQKTSSGTSSKDCGSSSTITKSATSSDNSSENREPQRMLPIRPPPEKRQRVPSAYNRFIK 76
344444444555555555555555555555677888999999*9999***************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 3.5E-13 | 1 | 76 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| GO:0010158 | Biological Process | abaxial cell fate specification | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MKALVQPNPP HQNLQNHQKT SSGTSSKDCG SSSTITKSAT SSDNSSENRE PQRMLPIRPP 60 PEKRQRVPSA YNRFIKCVFS YILLKCFGFL IRTKVFTKI* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF277378 | 3e-65 | JF277378.1 Aquilegia flabellata clone AA12 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010651636.1 | 1e-14 | PREDICTED: putative axial regulator YABBY 2 isoform X1 | ||||
| Refseq | XP_010651637.1 | 1e-14 | PREDICTED: putative axial regulator YABBY 2 isoform X3 | ||||
| Refseq | XP_020868331.1 | 8e-15 | putative axial regulator YABBY 2 isoform X2 | ||||
| Swissprot | Q9XFB0 | 2e-14 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
| TrEMBL | A0A2G5EEQ8 | 1e-66 | A0A2G5EEQ8_AQUCA; Uncharacterized protein | ||||
| STRING | Aquca_009_00652.1 | 3e-45 | (Aquilegia coerulea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08465.1 | 3e-09 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aqcoe1G074300.6.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




