![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aqcoe1G493900.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 76aa MW: 8360.08 Da PI: 10.5627 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 129.1 | 1.2e-40 | 8 | 75 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
++ ve kG+nPGlivllvv++lll+flvgny+ly+yaq++lPP+kkkPvskkklk+eklkqGv++PGe
Aqcoe1G493900.1.p 8 ENLVEPKGFNPGLIVLLVVASLLLIFLVGNYALYMYAQRTLPPKKKKPVSKKKLKKEKLKQGVSAPGE 75
6789***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 2.5E-38 | 12 | 75 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 2.0E-4 | 14 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MSDESKFENL VEPKGFNPGL IVLLVVASLL LIFLVGNYAL YMYAQRTLPP KKKKPVSKKK 60 LKKEKLKQGV SAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 9e-27 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 9e-27 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 6e-18 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A2G5D518 | 2e-44 | A0A2G5D518_AQUCA; Uncharacterized protein | ||||
| STRING | Aquca_027_00077.1 | 4e-45 | (Aquilegia coerulea) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aqcoe1G493900.1.p |




