PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aqcoe3G029400.1.p

Organism

Aquilegia coerulea

Taxonomic ID

218851

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia

Family

M-type_MADS

Protein Properties

Length: 171aa MW: 19208 Da PI: 10.4708

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aqcoe3G029400.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	75.7	3.5e-24	9	57	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ie++ rqvtfskRr+g++KKA+ELS+LC+ae+a+++fs+ gk + + Aqcoe3G029400.1.p 9 KKIESEDSRQVTFSKRRAGLFKKASELSILCGAEIAIVVFSPAGKAFSF 57 68******************************************97766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.2E-35	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	27.123	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.09E-28	1	74	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.97E-35	3	70	No hit	No description
PRINTS	PR00404	7.9E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.9E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.9E-23	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
MVRTKIEMKK IESEDSRQVT FSKRRAGLFK KASELSILCG AEIAIVVFSP AGKAFSFGHP 60 NVDSVVDSFL AGKPYKGANG NQHAVKKYSK VLDQLTTESK KSDAARKLRK TSLQNRQIPW 120 WEGPIENLGF NELQLLLSSY NRLQQNVGIR SKEEMYNNYL RSMLNGNHNV *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	4e-16	3	71	2	70	Myocyte-specific enhancer factor 2A
3mu6_B	4e-16	3	71	2	70	Myocyte-specific enhancer factor 2A
3mu6_C	4e-16	3	71	2	70	Myocyte-specific enhancer factor 2A
3mu6_D	4e-16	3	71	2	70	Myocyte-specific enhancer factor 2A
6byy_A	7e-16	1	66	1	66	MEF2 CHIMERA
6byy_B	7e-16	1	66	1	66	MEF2 CHIMERA
6byy_C	7e-16	1	66	1	66	MEF2 CHIMERA
6byy_D	7e-16	1	66	1	66	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX680233	0.0	JX680233.1 Aquilegia coerulea MADS-box protein AGL72 mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010277267.1	3e-45	PREDICTED: agamous-like MADS-box protein AGL61
Swissprot	Q9FKK2	3e-38	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A2G5CQ05	1e-123	A0A2G5CQ05_AQUCA; Uncharacterized protein
STRING	Aquca_041_00050.1	1e-124	(Aquilegia coerulea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	1e-40	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	Aqcoe3G029400.1.p

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]