PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aqcoe3G079200.1.p

Organism

Aquilegia coerulea

Taxonomic ID

218851

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia

Family

ZF-HD

Protein Properties

Length: 98aa MW: 10464.6 Da PI: 8.6934

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aqcoe3G079200.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	105.4	3.6e-33	28	84	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s geegt+ alkCaAC CHRnFHRreve+e Aqcoe3G079200.1.p 28 SVRYGECQKNHAAKIGGYAVDGCREFMAS-GEEGTSGALKCAACSCHRNFHRREVEYE 84 79************************9.999*******************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-20	26	94	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.4E-31	29	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.2E-26	30	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.433	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MKKRVTSKGG EGLYRSSTNT TTSSSARSVR YGECQKNHAA KIGGYAVDGC REFMASGEEG 60 TSGALKCAAC SCHRNFHRRE VEYEVVCECS SPSTNGR*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017975895.1	2e-42	PREDICTED: mini zinc finger protein 2
Refseq	XP_021297644.1	3e-42	mini zinc finger protein 2-like
Swissprot	Q9LJW5	2e-35	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A2G5ENV6	2e-63	A0A2G5ENV6_AQUCA; Uncharacterized protein
STRING	Aquca_006_00297.1	3e-64	(Aquilegia coerulea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-29	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Aqcoe3G079200.1.p

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]