![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aqcoe3G180200.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 97aa MW: 11710.6 Da PI: 11.715 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 105.3 | 4.5e-33 | 11 | 78 | 9 | 76 |
---TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
SBP 9 adlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
+dls++++yhrrh+vC+ hsk+p+ lv+g+eqrfC+q srfh l efDeekrsCr+rL++hn+rrr+
Aqcoe3G180200.1.p 11 SDLSKCRDYHRRHRVCKSHSKTPNLLVRGQEQRFCKQRSRFHLLVEFDEEKRSCRQRLDGHNRRRRRL 78
69****************************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 24.692 | 1 | 78 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.32E-29 | 11 | 81 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 1.2E-24 | 11 | 65 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.0E-23 | 12 | 77 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MLGRWLQLRV SDLSKCRDYH RRHRVCKSHS KTPNLLVRGQ EQRFCKQRSR FHLLVEFDEE 60 KRSCRQRLDG HNRRRRRLPL EGLFCPPKSV ICRQQG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 1e-20 | 10 | 77 | 17 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 60 | 77 | KRSCRQRLDGHNRRRRRL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021631025.1 | 9e-32 | squamosa promoter-binding-like protein 16 | ||||
| Swissprot | Q0JGI1 | 3e-30 | SPL2_ORYSJ; Squamosa promoter-binding-like protein 2 | ||||
| TrEMBL | A0A2G5CRG2 | 5e-62 | A0A2G5CRG2_AQUCA; Uncharacterized protein | ||||
| STRING | Aquca_040_00115.1 | 9e-63 | (Aquilegia coerulea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G50670.1 | 6e-26 | SBP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aqcoe3G180200.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




