![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aqcoe3G373700.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 104aa MW: 11945.8 Da PI: 9.5172 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 101.8 | 2.5e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
Aqcoe3G373700.1.p 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 33 | 2.6e-12 | 59 | 93 | 33 | 67 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRs 67
++ R+ll e+L+s+s keL qLe+qL+ slk+iR
Aqcoe3G373700.1.p 59 STSRNLLEEELGSISTKELDQLEHQLDMSLKQIRY 93
577*******************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.627 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.8E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.78E-39 | 2 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 1.44E-31 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.7E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 6.6E-9 | 59 | 93 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFST RGKLYEFCST 60 SRNLLEEELG SISTKELDQL EHQLDMSLKQ IRYQDSIYAR SAF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 6byy_A | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_B | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_C | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_D | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_A | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_B | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_C | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6bz1_D | 5e-21 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX680246 | 3e-99 | JX680246.1 Aquilegia coerulea MADS-box protein SEP2B mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010257958.1 | 4e-45 | PREDICTED: developmental protein SEPALLATA 1 | ||||
| Refseq | XP_028059218.1 | 4e-45 | MADS-box protein EJ2-like | ||||
| Swissprot | Q39685 | 7e-45 | CMB1_DIACA; MADS-box protein CMB1 | ||||
| TrEMBL | A0A2G5F5F0 | 3e-68 | A0A2G5F5F0_AQUCA; Uncharacterized protein | ||||
| STRING | Aquca_002_00913.1 | 5e-69 | (Aquilegia coerulea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G24260.1 | 1e-44 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aqcoe3G373700.1.p |




