![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aqcoe4G024100.3.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 172aa MW: 19531.4 Da PI: 10.413 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 98.4 | 2.9e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLC+aeva+i+fss+g+lyeys+
Aqcoe4G024100.3.p 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYSN 59
79***********************************************95 PP
| |||||||
| 2 | K-box | 94.5 | 1.7e-31 | 78 | 160 | 5 | 87 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87
++ s++ea+a+ +qqe++kL+++i +Lq+ +R+llGe+L++L++++L+ +e+++e +++kiR+kKnell+++ie++qk+ + +
Aqcoe4G024100.3.p 78 NSGSVSEANAQFYQQEVTKLRNQIASLQNHNRNLLGESLSNLNIRDLKPIEKKIEGGISKIRAKKNELLFAEIEYMQKRVNIA 160
33449*************************************************************************98765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.613 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.88E-33 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.16E-42 | 2 | 76 | No hit | No description |
| PRINTS | PR00404 | 1.4E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.4E-22 | 85 | 161 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.147 | 87 | 171 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 172 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCE AEVALIVFSS RGRLYEYSNN 60 SVKKTIERYK KACTDSTNSG SVSEANAQFY QQEVTKLRNQ IASLQNHNRN LLGESLSNLN 120 IRDLKPIEKK IEGGISKIRA KKNELLFAEI EYMQKRVNIA SKSSLNVGHL Y* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 6byy_C | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_A | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_B | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_C | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_D | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6c9l_A | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY464111 | 0.0 | AY464111.1 Aquilegia alpina AGAMOUS-like protein mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019233177.1 | 3e-92 | PREDICTED: floral homeotic protein AGAMOUS isoform X1 | ||||
| Swissprot | Q40885 | 4e-93 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | A0A2G5C113 | 1e-119 | A0A2G5C113_AQUCA; Uncharacterized protein | ||||
| STRING | Aquca_136_00010.1 | 1e-107 | (Aquilegia coerulea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.1 | 9e-78 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aqcoe4G024100.3.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




