PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aqcoe4G239000.1.p

Organism

Aquilegia coerulea

Taxonomic ID

218851

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia

Family

MYB_related

Protein Properties

Length: 70aa MW: 7989.84 Da PI: 7.5218

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aqcoe4G239000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.1	1.3e-10	22	62	3	45
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +++++E l+ + k+ G + W++Ia +++ gRt++q+ +w Aqcoe4G239000.1.p 22 NFSEDEKTLITRMYKLVGER-WSLIAGRIP-GRTAEQIEKYWT 62 89****************.*****.*********5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.327	15	69	IPR017930	Myb domain
SMART	SM00717	1.6E-8	19	67	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.25E-9	20	63	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	5.0E-13	22	63	IPR009057	Homeodomain-like
CDD	cd00167	6.50E-8	22	61	No hit	No description
Pfam	PF00249	4.0E-9	22	62	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MDYTSAYTSV HSQVLDGNNQ DNFSEDEKTL ITRMYKLVGE RWSLIAGRIP GRTAEQIEKY 60 WTSRNSTTK*

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269\|PubMed:15063185, ECO:0000269\|PubMed:15584952}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC253836	4e-42	AC253836.1 Aquilegia coerulea clone COL06-D05, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023875994.1	3e-26	MYB-like transcription factor ETC1 isoform X1
Swissprot	Q9LNI5	3e-17	ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBL	A0A2G5E590	3e-44	A0A2G5E590_AQUCA; Uncharacterized protein
STRING	Aquca_012_00145.1	6e-45	(Aquilegia coerulea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01380.1	1e-19	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Aqcoe4G239000.1.p

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Kurata T,Wada T Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] Tominaga-Wada R,Kurata T,Wada T Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Tominaga-Wada R,Wada T Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129]