![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aqcoe5G451500.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10570 Da PI: 9.2235 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 26 | 2.2e-08 | 29 | 67 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
++ +E++l+++ +k+ G + W++Ia +++ gR ++++ +w
Aqcoe5G451500.1.p 29 MSDQEEDLIYRMHKLVGDR-WDLIAGRIP-GRKPEEIERFW 67
5899*************99.*********.*********99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 4.0E-5 | 25 | 73 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.83E-5 | 29 | 67 | No hit | No description |
| Pfam | PF00249 | 1.3E-7 | 30 | 68 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.1E-7 | 30 | 68 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 4.5E-10 | 30 | 68 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MDKRRRKQQK TTKQEFEEVS SIEWEFIQMS DQEEDLIYRM HKLVGDRWDL IAGRIPGRKP 60 EEIERFWIMK HGEAFAQDRK GKGCRNS* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 1 | 7 | DKRRRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010266468.1 | 1e-41 | PREDICTED: transcription factor TRY | ||||
| Swissprot | Q8GV05 | 1e-35 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A2G5CTG8 | 4e-57 | A0A2G5CTG8_AQUCA; Uncharacterized protein | ||||
| STRING | Aquca_037_00095.1 | 7e-58 | (Aquilegia coerulea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 1e-33 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aqcoe5G451500.1.p |




