![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.04S25 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | CAMTA | ||||||||
| Protein Properties | Length: 70aa MW: 8271.71 Da PI: 7.5048 | ||||||||
| Description | CAMTA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CG-1 | 42.8 | 1e-13 | 6 | 37 | 75 | 106 |
CG-1 75 vggvevlycyYahseenptfqrrcywlLeeel 106
vg+v+vl+cyYah+e+n++fqrr+yw+Le l
Aradu.04S25 6 VGSVDVLHCYYAHGETNEKFQRRSYWMLEPIL 37
899*************************9765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51437 | 21.301 | 1 | 54 | IPR005559 | CG-1 DNA-binding domain |
| Pfam | PF03859 | 1.8E-9 | 6 | 35 | IPR005559 | CG-1 DNA-binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MLFCSVGSVD VLHCYYAHGE TNEKFQRRSY WMLEPILAEV ENFARFWLKL KTLLLIALAS 60 YLIKLHAEYS |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.04S25 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020975837.1 | 8e-16 | calmodulin-binding transcription activator 1-like isoform X1 | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G09410.2 | 4e-15 | ethylene induced calmodulin binding protein | ||||




