![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.0BJ82 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 118aa MW: 13963.9 Da PI: 8.2545 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 98 | 7.2e-31 | 18 | 98 | 3 | 83 |
NF-YC 3 ksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaav 83
sf +++e+a+dfkn +Plar++k++k++edv +isae+Pv+l+kac+lfi ++tl+sw +a++nkr+ ++++di++++
Aradu.0BJ82 18 WSFQRREVEQAHDFKNGLFPLARVRKMMKVEEDVDRISAEVPVVLAKACDLFIRNVTLQSWHQAQKNKRSIIQRQDINSTM 98
34455569*********************************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 6.54E-21 | 14 | 100 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-25 | 27 | 96 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.9E-17 | 36 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MGNQNSTQQH QIEIENLWSF QRREVEQAHD FKNGLFPLAR VRKMMKVEED VDRISAEVPV 60 VLAKACDLFI RNVTLQSWHQ AQKNKRSIIQ RQDINSTMDS FRDACHNIEY FKRLMSEA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 3e-23 | 21 | 98 | 3 | 80 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.0BJ82 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015937733.1 | 4e-84 | nuclear transcription factor Y subunit C-1-like | ||||
| Swissprot | Q9FMV5 | 4e-26 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
| TrEMBL | A0A445C211 | 3e-82 | A0A445C211_ARAHY; Uncharacterized protein | ||||
| STRING | XP_006493208.1 | 2e-25 | (Citrus sinensis) | ||||
| STRING | XP_006436849.1 | 2e-25 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF23344 | 2 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63470.2 | 2e-28 | nuclear factor Y, subunit C4 | ||||




