![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.15PR5 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 95aa MW: 10830.4 Da PI: 10.1693 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.9 | 5e-32 | 31 | 81 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey++
Aradu.15PR5 31 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAN 81
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.824 | 23 | 83 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.18E-30 | 23 | 87 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.6E-42 | 23 | 82 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.29E-40 | 24 | 87 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 25 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.0E-34 | 25 | 45 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.5E-27 | 32 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.0E-34 | 45 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.0E-34 | 60 | 81 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MELPHQSGGG GDAHEGSSSQ KRMGRGKIEI KRIENTTNRQ VTFCKRRNGL LKKAYELSVL 60 CDAEVALVVF SSRGRLYEYA NNRFKSLNYF YIIIL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-21 | 23 | 82 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.15PR5 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY178837 | 2e-47 | AY178837.1 Momordica charantia mads-box transcription factor mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015953263.1 | 6e-54 | agamous-like MADS-box protein AGL5 | ||||
| Refseq | XP_015953270.1 | 6e-54 | agamous-like MADS-box protein AGL5 | ||||
| Refseq | XP_025693014.1 | 6e-54 | agamous-like MADS-box protein AGL5 | ||||
| Refseq | XP_025693020.1 | 6e-54 | agamous-like MADS-box protein AGL5 | ||||
| Swissprot | P29381 | 5e-39 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
| TrEMBL | A0A445EV88 | 3e-53 | A0A445EV88_ARAHY; Uncharacterized protein | ||||
| STRING | XP_007146364.1 | 6e-43 | (Phaseolus vulgaris) | ||||
| STRING | XP_006293200.1 | 8e-41 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 1e-43 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




