PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aradu.1RN6D

Organism

Arachis duranensis

Taxonomic ID

130453

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

TCP

Protein Properties

Length: 83aa MW: 9935.54 Da PI: 10.9379

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.1RN6D	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	89	1e-27	2	51	4	53
TCP 4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53 kkdrh kihT++++RdRRvRls+e+ ++fFdLqd+L f k+s+t+eWL++ Aradu.1RN6D 2 KKDRHNKIHTSQELRDRRVRLSSEISRKFFDLQDMLEFNKPSNTLEWLFT 51 9***********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	6.7E-25	2	51	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	23.92	2	60	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MKKDRHNKIH TSQELRDRRV RLSSEISRKF FDLQDMLEFN KPSNTLEWLF TIEAFKVKWK 60 GGKGKLIFGR FDVKGYVTGV WKS

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.1RN6D

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007143293.1	5e-26	hypothetical protein PHAVU_007G060100g
Refseq	XP_014523924.1	6e-26	transcription factor DICHOTOMA-like
Refseq	XP_020232454.2	7e-26	transcription factor DICHOTOMA isoform X1
Refseq	XP_027933862.1	4e-26	transcription factor DICHOTOMA-like
Refseq	XP_029128870.1	4e-26	transcription factor DICHOTOMA isoform X2
Swissprot	Q9SBV9	4e-19	CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment)
TrEMBL	A0A0S3SMV7	1e-24	A0A0S3SMV7_PHAAN; Uncharacterized protein
TrEMBL	A0A1S3W0Y8	1e-24	A0A1S3W0Y8_VIGRR; transcription factor DICHOTOMA-like
TrEMBL	V7BBQ4	1e-24	V7BBQ4_PHAVU; Uncharacterized protein
STRING	XP_007143293.1	2e-25	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1738	32	94

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G67260.2	3e-18	TCP family protein

Publications ? help Back to Top
Vieira CP,Vieira J,Charlesworth D Evolution of the cycloidea gene family in Antirrhinum and Misopates. Mol. Biol. Evol., 1999. 16(11): p. 1474-83 [PMID:10555278] Gubitz T,Caldwell A,Hudson A Rapid molecular evolution of CYCLOIDEA-like genes in Antirrhinum and its relatives. Mol. Biol. Evol., 2003. 20(9): p. 1537-44 [PMID:12832647]