PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aradu.3MQ4D

Organism

Arachis duranensis

Taxonomic ID

130453

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

Protein Properties

Length: 110aa MW: 12265 Da PI: 10.372

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.3MQ4D	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	42.8	9.1e-14	5	56	31	82
.--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 + +++l+ +d++g +W +k+i+r++++++++t+GW+ Fv +++L +gD +v Aradu.3MQ4D 5 TPTQELVAKDLHGYEWGFKHIVRGQPRKHLITTGWSTFVASKRLVAGDPFVG 56 445699******************************************9885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	10.306	1	69	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	3.4E-16	2	82	IPR015300	DNA-binding pseudobarrel domain
SuperFamily	SSF101936	5.49E-16	2	96	IPR015300	DNA-binding pseudobarrel domain
CDD	cd10017	1.19E-9	4	52	No hit	No description
Pfam	PF02362	1.9E-11	5	55	IPR003340	B3 DNA binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
MSQPTPTQEL VAKDLHGYEW GFKHIVRGQP RKHLITTGWS TFVASKRLVA GDPFVGHNGE 60 LRAELRRSTP QPSSMPSSVI SSQSMHLGVL ATAYHDVATQ TLFVVYYKSR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ldv_A	5e-42	1	110	155	267	Auxin response factor 1
4ldw_A	5e-42	1	110	155	267	Auxin response factor 1
4ldw_B	5e-42	1	110	155	267	Auxin response factor 1
4ldx_A	5e-42	1	110	155	267	Auxin response factor 1
4ldx_B	5e-42	1	110	155	267	Auxin response factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269\|PubMed:12036261}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.3MQ4D

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016183752.1	4e-54	auxin response factor 9 isoform X1
Refseq	XP_020971749.1	2e-54	auxin response factor 9 isoform X2
Refseq	XP_025633467.1	4e-54	auxin response factor 9
Swissprot	Q9ZPY6	2e-49	ARFK_ARATH; Auxin response factor 11
TrEMBL	A0A2U1P256	2e-52	A0A2U1P256_ARTAN; Auxin response factor
TrEMBL	A0A444ZNN2	4e-52	A0A444ZNN2_ARAHY; Auxin response factor
STRING	XP_010266558.1	2e-52	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF15884	6	10

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G23980.1	6e-43	auxin response factor 9

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wójcikowska B,Gaj MD Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787]