 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.46FSJ | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 70aa MW: 7967.94 Da PI: 10.8675 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 30.9 | 9.2e-10 | 12 | 61 | 2 | 53 |
FAR1 2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerr 53
Y++YAk +GFs+r+++++++ +ei+++ +Cs+egk +++ ++t + +
Aradu.46FSJ 12 VYRNYAKAAGFSTRVRSTNRK--GNEIKNQLITCSREGKWKSKISQTAQGTK 61
7***************98887..8889************9999888554444 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 4.3E-7 | 12 | 59 | IPR004330 | FAR1 DNA binding domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MTFTTLEDAG KVYRNYAKAA GFSTRVRSTN RKGNEIKNQL ITCSREGKWK SKISQTAQGT 60 KHVHSSYNRE |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.46FSJ |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HQ637178 | 2e-59 | HQ637178.1 Arachis hypogaea clone AHF-205D04 NBS-LRR gene cluster, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020981694.1 | 2e-31 | protein FAR1-RELATED SEQUENCE 5-like | ||||
| TrEMBL | A0A444ZP79 | 9e-31 | A0A444ZP79_ARAHY; Uncharacterized protein | ||||
| TrEMBL | A0A444ZQG0 | 2e-31 | A0A444ZQG0_ARAHY; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF21 | 14 | 477 |
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|