![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.9Z71X | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 104aa MW: 12013.5 Da PI: 8.7863 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 123.4 | 1e-38 | 13 | 90 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
+Cq+++C adl+ ak+y+rrhkvCe h+kapvvlvsg++qrfCqqCs+fhel fD++krsCr+rLa+hnerrrk+qa
Aradu.9Z71X 13 CCQADECLADLQAAKRYNRRHKVCERHAKAPVVLVSGTRQRFCQQCSKFHELALFDDNKRSCRERLASHNERRRKAQA 90
6**************************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.6E-30 | 11 | 75 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 29.547 | 11 | 88 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 5.1E-35 | 12 | 92 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.5E-31 | 14 | 87 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
WNSSSSCTAL SYCCQADECL ADLQAAKRYN RRHKVCERHA KAPVVLVSGT RQRFCQQCSK 60 FHELALFDDN KRSCRERLAS HNERRRKAQA HHADLQPQPE SDIN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 1e-30 | 3 | 87 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.9Z71X |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015963401.1 | 4e-72 | squamosa promoter-binding-like protein 3 isoform X1 | ||||
| Refseq | XP_020978505.1 | 5e-72 | squamosa promoter-binding-like protein 3 isoform X1 | ||||
| Swissprot | Q6Z461 | 6e-33 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | A0A444WUS8 | 2e-69 | A0A444WUS8_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA11G08905.1 | 9e-37 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 3e-33 | squamosa promoter binding protein-like 4 | ||||




