![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.D6IHD | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 90aa MW: 10404.9 Da PI: 9.4681 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 41.1 | 3.3e-13 | 22 | 86 | 32 | 97 |
--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
B3 32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
++k + l++ + ++W v+liy +++ +l++G +F+++n+Lk+gD+++F+l+ r+++el ++f
Aradu.D6IHD 22 KTKYVNLRN-REKQWPVTLIYYPTRKIAILSAGSVSFARENNLKAGDICIFELVYREGAELDAHIF 86
333456555.78******************************************999999988887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 9.164 | 1 | 89 | IPR003340 | B3 DNA binding domain |
| SMART | SM01019 | 0.0039 | 8 | 89 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 1.2E-11 | 18 | 86 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 3.34E-11 | 19 | 86 | IPR015300 | DNA-binding pseudobarrel domain |
| CDD | cd10017 | 1.40E-11 | 20 | 86 | No hit | No description |
| Pfam | PF02362 | 7.9E-11 | 22 | 86 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MTYGVLHFIA FQQSSSENTF KKTKYVNLRN REKQWPVTLI YYPTRKIAIL SAGSVSFARE 60 NNLKAGDICI FELVYREGAE LDAHIFLRDA |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.D6IHD |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016179830.1 | 3e-16 | B3 domain-containing protein Os03g0619600-like | ||||
| Refseq | XP_029144690.1 | 3e-16 | B3 domain-containing protein REM16-like | ||||
| TrEMBL | A0A444ZT89 | 2e-53 | A0A444ZT89_ARAHY; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF17222 | 2 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G49480.1 | 1e-08 | related to vernalization1 1 | ||||




