PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aradu.EN5DH

Organism

Arachis duranensis

Taxonomic ID

130453

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

Protein Properties

Length: 93aa MW: 10254.9 Da PI: 9.4365

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.EN5DH	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	33.5	7.7e-11	9	50	55	98
ETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 55 ksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 +++r+++t+GW+ Fv +++L gD++vF + +++ l+v+++ Aradu.EN5DH 9 QPCRHLITTGWSTFVASKRLVIGDTFVFLRG--HNGDLCVGLRH 50 6789*************************43..67777999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	9.305	1	52	IPR003340	B3 DNA binding domain
Pfam	PF02362	2.1E-8	8	50	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	7.8E-14	9	65	IPR015300	DNA-binding pseudobarrel domain
SuperFamily	SSF101936	3.4E-9	10	79	IPR015300	DNA-binding pseudobarrel domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MSNMDLQCQP CRHLITTGWS TFVASKRLVI GDTFVFLRGH NGDLCVGLRH NTSQPSSMPS 60 SMISSQSMHL GVLATASHAV VTQTLFVVYY KPR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ldv_A	5e-33	9	93	183	267	Auxin response factor 1
4ldw_A	5e-33	9	93	183	267	Auxin response factor 1
4ldw_B	5e-33	9	93	183	267	Auxin response factor 1
4ldx_A	6e-33	9	93	183	267	Auxin response factor 1
4ldx_B	6e-33	9	93	183	267	Auxin response factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269\|PubMed:12036261}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.EN5DH

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013448901.1	2e-39	auxin response factor 9
Swissprot	Q9C5W9	5e-37	ARFR_ARATH; Auxin response factor 18
TrEMBL	A0A182BLY8	6e-39	A0A182BLY8_BOENI; Auxin response factor
STRING	Aquca_013_00067.1	2e-38	(Aquilegia coerulea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G61830.1	1e-31	auxin response factor 18

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wójcikowska B,Gaj MD Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787]