![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.IXX59 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 97aa MW: 11636.4 Da PI: 10.3957 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.5 | 5.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W+ eEd++l+ v+++G +W+ ++ g+ R++k+c++rw++yl
Aradu.IXX59 14 KGAWSREEDQRLIAFVQRYGHSNWRQLPKFAGLARCGKSCRLRWLNYL 61
79*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-22 | 8 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.004 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.9E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 8.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.4E-24 | 15 | 90 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.52E-10 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.704 | 62 | 97 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 4.7E-10 | 65 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MVRAPFYDKY GVKKGAWSRE EDQRLIAFVQ RYGHSNWRQL PKFAGLARCG KSCRLRWLNY 60 LRPNLKHGNY TQEEEELIIK LHQQLGNRYV FTISTNF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 7e-19 | 14 | 90 | 4 | 79 | MYB PROTO-ONCOGENE PROTEIN |
| 1h8a_C | 1e-18 | 14 | 90 | 27 | 102 | MYB TRANSFORMING PROTEIN |
| 1mse_C | 7e-19 | 14 | 90 | 4 | 79 | C-Myb DNA-Binding Domain |
| 1msf_C | 7e-19 | 14 | 90 | 4 | 79 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.IXX59 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015039 | 9e-53 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015953561.1 | 5e-61 | transcription factor MYB14-like | ||||
| Swissprot | P20024 | 6e-40 | MYB1_MAIZE; Myb-related protein Zm1 | ||||
| TrEMBL | A0A445E0S6 | 3e-58 | A0A445E0S6_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA06G45531.1 | 3e-52 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31180.1 | 2e-41 | myb domain protein 14 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




