![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.JGT0L | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 115aa MW: 13141 Da PI: 9.3103 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 58.8 | 1.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
Aradu.JGT0L 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLERCGKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.287 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.0E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.0E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 8.24E-24 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.81E-12 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.286 | 62 | 101 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-8 | 65 | 87 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKAGLERCG KSCRLRWTNY 60 LRPDIKRGKF SLQEEQAIIQ LHALLGNSTV INIQEHLINS RVVSYSHTFA KEDRQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-16 | 12 | 87 | 5 | 79 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.JGT0L |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016194299.1 | 2e-58 | transcription factor MYB35-like | ||||
| Refseq | XP_018806959.1 | 4e-59 | PREDICTED: myb-related protein Myb4-like | ||||
| Refseq | XP_025649949.1 | 2e-58 | transcription factor MYB106 | ||||
| Swissprot | Q9LXF1 | 2e-56 | MYB16_ARATH; Transcription factor MYB16 | ||||
| TrEMBL | A0A2I0I4Q4 | 8e-58 | A0A2I0I4Q4_PUNGR; Uncharacterized protein | ||||
| TrEMBL | A0A2I4DII2 | 8e-58 | A0A2I4DII2_JUGRE; myb-related protein Myb4-like | ||||
| TrEMBL | A0A371I2X5 | 3e-57 | A0A371I2X5_MUCPR; Transcription factor MYB16 (Fragment) | ||||
| TrEMBL | A0A444ZQ03 | 4e-57 | A0A444ZQ03_ARAHY; Uncharacterized protein | ||||
| STRING | AES74748 | 1e-57 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15310.1 | 6e-59 | myb domain protein 16 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




