![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.K71EN | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 96aa MW: 11187.7 Da PI: 8.7189 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 44.3 | 3.5e-14 | 38 | 71 | 26 | 59 |
EE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 26 rCtsagCpvkkkversaedpkvveitYegeHnhe 59
rCt +C+v+k+ver+ +dp+++++tYeg+Hnhe
Aradu.K71EN 38 RCTNVKCNVRKHVERAIDDPRAFVTTYEGKHNHE 71
9********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 17.259 | 38 | 73 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.2E-9 | 38 | 71 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.14E-11 | 38 | 73 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.2E-6 | 38 | 72 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-12 | 38 | 73 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MEKKRVEVEQ ESLTSLSGRY KDFIKDFISI YELTFTTRCT NVKCNVRKHV ERAIDDPRAF 60 VTTYEGKHNH EMPIKNINPN VPSERDSQAS LSKDKP |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.K71EN |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015970013.1 | 8e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_015970015.1 | 8e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_016207944.1 | 7e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_016207945.1 | 7e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_016207946.1 | 7e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_025605078.1 | 7e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_025605079.1 | 7e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_025663689.1 | 8e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_025663690.1 | 8e-35 | WRKY transcription factor 44 | ||||
| Refseq | XP_025663691.1 | 8e-35 | WRKY transcription factor 44 | ||||
| TrEMBL | A0A445D4E5 | 2e-48 | A0A445D4E5_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA03G33376.1 | 2e-26 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37260.2 | 2e-15 | WRKY family protein | ||||




