![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.P1F7Y | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 67aa MW: 7834.08 Da PI: 9.3253 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.8 | 1.2e-13 | 28 | 67 | 1 | 42 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42
rg+ T++E+e++v++++ lG++ W+ Ia +++ gRt +++k+
Aradu.P1F7Y 28 RGNITPQEEEIIVKLHAVLGNR-WSVIAGHLP-GRTYNEIKN 67
8999******************.*********.*******97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.07E-16 | 10 | 67 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-9 | 11 | 34 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 19.805 | 23 | 67 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.7E-4 | 27 | 67 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.0E-11 | 28 | 67 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.07E-7 | 32 | 67 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-16 | 35 | 67 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 67 aa Download sequence Send to blast |
MEVVAQECWT LKSCRLRWIN YLRSDVKRGN ITPQEEEIIV KLHAVLGNRW SVIAGHLPGR 60 TYNEIKN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 5e-14 | 12 | 67 | 43 | 98 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.P1F7Y |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB573734 | 3e-42 | AB573734.1 Lupinus albus LaMYB11 mRNA for R2R3-MYB transcription factor, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016172314.1 | 3e-31 | transcription factor MYB111 | ||||
| Refseq | XP_025630174.1 | 3e-31 | transcription factor MYB111-like | ||||
| Refseq | XP_025679220.1 | 3e-31 | transcription factor MYB111-like | ||||
| Swissprot | O22264 | 8e-29 | MYB12_ARATH; Transcription factor MYB12 | ||||
| TrEMBL | A0A371GA29 | 2e-29 | A0A371GA29_MUCPR; Transcription factor MYB111 (Fragment) | ||||
| TrEMBL | A0A445AWR1 | 8e-30 | A0A445AWR1_ARAHY; Uncharacterized protein | ||||
| TrEMBL | A0A445EM33 | 7e-30 | A0A445EM33_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA07G37142.1 | 4e-30 | (Glycine max) | ||||
| STRING | GLYMA17G03480.2 | 4e-30 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47460.1 | 3e-31 | myb domain protein 12 | ||||




