![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.PEG2Q | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 84aa MW: 9857.29 Da PI: 9.1195 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 36.2 | 1.3e-11 | 2 | 77 | 24 | 99 |
NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
ri+ i+ka++ ++s ea ++ ka e f+ +++ ++++ + +r++l +a +v++ ++fl d vp+
Aradu.PEG2Q 2 NRIRTIVKAEDPDLRVSQEAIFVVNKAAEKFLEQFAQDGYVRCVQERRKSLSYKHLAHVVSKQRRYEFLSDFVPET 77
7*******98777789*********************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 1.1E-13 | 1 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 6.2E-22 | 1 | 76 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.61E-16 | 9 | 77 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MNRIRTIVKA EDPDLRVSQE AIFVVNKAAE KFLEQFAQDG YVRCVQERRK SLSYKHLAHV 60 VSKQRRYEFL SDFVPETLKA EDAL |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.PEG2Q |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015952380.1 | 3e-57 | ribosomal RNA-processing protein 8 isoform X1 | ||||
| TrEMBL | A0A445A9W0 | 1e-55 | A0A445A9W0_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA11G20740.1 | 5e-40 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF12016 | 30 | 31 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07980.1 | 3e-26 | nuclear factor Y, subunit C10 | ||||




