PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aradu.Q22GT

Organism

Arachis duranensis

Taxonomic ID

130453

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

M-type_MADS

Protein Properties

Length: 87aa MW: 10038.6 Da PI: 10.3197

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.Q22GT	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	77.2	1.2e-24	25	75	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrq+tfskRrng+ KK +ELSvLCd++va+i fs++++l +ss Aradu.Q22GT 25 KKIENVRNRQITFSKRRNGLVKKGYELSVLCDVDVALITFSPSDRLALFSS 75 78********************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.1E-26	17	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-22	19	39	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.98E-24	21	78	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	24.432	21	77	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.8E-23	26	70	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-22	39	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-22	54	75	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MKMMFTLRSS SSEYENNTIP RVPIKKIENV RNRQITFSKR RNGLVKKGYE LSVLCDVDVA 60 LITFSPSDRL ALFSSSTTFN YSVYSFL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1n6j_A	3e-15	21	85	4	72	Myocyte-specific enhancer factor 2B
1n6j_B	3e-15	21	85	4	72	Myocyte-specific enhancer factor 2B
1tqe_P	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
1tqe_R	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
1tqe_S	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
6byy_A	3e-15	20	85	4	73	MEF2 CHIMERA
6byy_B	3e-15	20	85	4	73	MEF2 CHIMERA
6byy_C	3e-15	20	85	4	73	MEF2 CHIMERA
6byy_D	3e-15	20	85	4	73	MEF2 CHIMERA
6bz1_A	3e-15	20	85	4	73	MEF2 CHIMERA
6bz1_B	3e-15	20	85	4	73	MEF2 CHIMERA
6bz1_C	3e-15	20	85	4	73	MEF2 CHIMERA
6bz1_D	3e-15	20	85	4	73	MEF2 CHIMERA
6c9l_A	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
6c9l_B	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
6c9l_C	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
6c9l_D	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
6c9l_E	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
6c9l_F	3e-15	20	85	4	73	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.Q22GT

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_029144619.1	5e-26	agamous-like MADS-box protein AGL104
Swissprot	Q9LM46	6e-23	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A444WNJ1	2e-50	A0A444WNJ1_ARAHY; Uncharacterized protein
STRING	XP_006472982.1	2e-23	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	2e-25	AGAMOUS-like 104

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]