![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.S93F6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 95aa MW: 11021.9 Da PI: 11.0178 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 162.6 | 2.5e-50 | 2 | 75 | 1 | 74 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgsk 74
++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrk ++
Aradu.S93F6 2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKVTN 75
5899******************************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 1.6E-47 | 3 | 76 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNF KLPKHCDNNE VLKALCNEAG 60 WTVEPDGTTY RKVTNLTPLK RVPVILFYLI GIMVS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 2e-21 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May function in brassinosteroid signaling. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.S93F6 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016702634.1 | 1e-46 | PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 | ||||
| Refseq | XP_016702636.1 | 1e-46 | PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 | ||||
| Swissprot | Q5Z9E5 | 1e-28 | BZR3_ORYSJ; Protein BZR1 homolog 3 | ||||
| TrEMBL | A0A1U8KJC4 | 2e-45 | A0A1U8KJC4_GOSHI; BES1/BZR1 homolog protein 4-like isoform X1 | ||||
| TrEMBL | A0A2P5WYB4 | 6e-46 | A0A2P5WYB4_GOSBA; Uncharacterized protein | ||||
| STRING | XP_010675300.1 | 2e-40 | (Beta vulgaris) | ||||
| STRING | XP_009352718.1 | 7e-40 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF15152 | 11 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G78700.1 | 1e-28 | BES1/BZR1 homolog 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




