![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.WC8FK | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 90aa MW: 10296.1 Da PI: 9.846 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.9 | 1.1e-13 | 22 | 65 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
++ Ede+l+ +++++G g+W+++++ g+ R++k+c +rw +yl
Aradu.WC8FK 22 SPKEDEKLLMYITKYGHGCWSSVPKQAGLQRSGKSCSLRWINYL 65
789***************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.005 | 13 | 69 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.7E-6 | 17 | 67 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-18 | 22 | 70 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.5E-13 | 22 | 74 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.89E-9 | 22 | 65 | No hit | No description |
| Pfam | PF00249 | 1.3E-11 | 22 | 65 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MNNNGKTLLL LQAEASEGSM VSPKEDEKLL MYITKYGHGC WSSVPKQAGL QRSGKSCSLR 60 WINYLRPDLK FGIFLLLLFS LQPQFRYLLL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.WC8FK |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018453030.1 | 2e-28 | PREDICTED: transcription factor MYB86 isoform X2 | ||||
| Swissprot | Q8LPH6 | 1e-25 | MYB86_ARATH; Transcription factor MYB86 | ||||
| TrEMBL | A0A2I0HV64 | 3e-27 | A0A2I0HV64_PUNGR; Uncharacterized protein | ||||
| TrEMBL | D8RDI4 | 3e-27 | D8RDI4_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ29750 | 5e-28 | (Selaginella moellendorffii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G01680.3 | 8e-28 | myb domain protein 55 | ||||




