![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aradu.XSE4D | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | SRS | ||||||||
| Protein Properties | Length: 95aa MW: 10480.8 Da PI: 8.2245 | ||||||||
| Description | SRS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF702 | 56.6 | 1e-17 | 14 | 47 | 5 | 38 |
DUF702 5 tasCqdCGnqakkdCaheRCRtCCksrgfdCath 38
+++C dCGnqakkdC+++RCRtCCk++gf+C th
Aradu.XSE4D 14 SSKCSDCGNQAKKDCSYTRCRTCCKNKGFHCPTH 47
679******************************* PP
| |||||||
| 2 | DUF702 | 53.3 | 1e-16 | 48 | 86 | 104 | 142 |
DUF702 104 slPeevsseavfrcvrvssvddgeeelaYqtavsigGhv 142
++P+ +ss a+frcvrv+s+d++ +e+aYqt+v+igGh
Aradu.XSE4D 48 EFPASMSSVAIFRCVRVRSMDESVNEIAYQTSVNIGGHA 86
79************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05142 | 1.1E-13 | 15 | 47 | IPR007818 | Protein of unknown function DUF702 |
| TIGRFAMs | TIGR01623 | 6.1E-18 | 16 | 47 | IPR006510 | Zinc finger, lateral root primordium type 1 |
| Pfam | PF05142 | 9.8E-12 | 48 | 86 | IPR007818 | Protein of unknown function DUF702 |
| TIGRFAMs | TIGR01624 | 1.6E-14 | 49 | 85 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MEGQEALKGT SSFSSKCSDC GNQAKKDCSY TRCRTCCKNK GFHCPTHEFP ASMSSVAIFR 60 CVRVRSMDES VNEIAYQTSV NIGGHALINH HHQPP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Aradu.XSE4D |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027357012.1 | 2e-33 | protein SHI RELATED SEQUENCE 3-like | ||||
| Swissprot | Q9SJT8 | 9e-25 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
| TrEMBL | K7KHH5 | 1e-30 | K7KHH5_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA04G01125.1 | 2e-31 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF30470 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G21400.1 | 4e-27 | SHI-related sequence3 | ||||




