![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.0086s0004.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 177aa MW: 20669.4 Da PI: 10.1698 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.5 | 1.5e-13 | 30 | 74 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
W++eEd++l + + ++G+++W+ Ia+++ ++ qc+ rw++yl
Araha.0086s0004.1.p 30 TWSPEEDDILRKQISLFGTENWAIIASKFT-DKSTRQCRRRWYTYL 74
6****************************9.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 46.8 | 6.6e-15 | 80 | 123 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg W++eEd ll +a +++G++ W+ Ia+ + gRt++ +k+r+ +
Araha.0086s0004.1.p 80 RGGWSPEEDTLLCEAQRLFGNR-WTEIAKVVS-GRTDNAVKNRFTT 123
789*******************.*********.**********976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.628 | 23 | 74 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.26E-26 | 27 | 121 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.1E-12 | 27 | 76 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.87E-11 | 30 | 74 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-20 | 31 | 82 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 1.4E-15 | 31 | 91 | No hit | No description |
| PROSITE profile | PS51294 | 20.812 | 75 | 129 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.4E-15 | 79 | 127 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.3E-20 | 83 | 128 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.12E-10 | 83 | 124 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MEETTKQNKK KKKILVNSDD SKKKERHIVT WSPEEDDILR KQISLFGTEN WAIIASKFTD 60 KSTRQCRRRW YTYLNSDFKR GGWSPEEDTL LCEAQRLFGN RWTEIAKVVS GRTDNAVKNR 120 FTTLCKKRAK HEAMAKENRI ACCVNSNNKR LLFPDDTQDS KIFAHSLGEF SFHHHT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 3e-26 | 31 | 129 | 10 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:16155180). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Plays a minor role in lateral roots (LRs) initiation (PubMed:26578065). Involved complementarily in establishing the gravitropic set-point angles of lateral roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells of primary and lateral roots (PubMed:26578169). {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.0086s0004.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF175994 | 0.0 | AF175994.2 Arabidopsis thaliana putative transcription factor (MYB88) mRNA, complete cds. | |||
| GenBank | AK226575 | 0.0 | AK226575.1 Arabidopsis thaliana mRNA for hypothetical protein, clone: RAFL07-13-I18. | |||
| GenBank | AY550305 | 0.0 | AY550305.1 Arabidopsis thaliana MYB transcription factor (at2g02825) mRNA, complete cds. | |||
| GenBank | BT026343 | 0.0 | BT026343.1 Arabidopsis thaliana At2g02820 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001030957.1 | 1e-101 | myb domain protein 88 | ||||
| Refseq | NP_001325364.1 | 1e-102 | myb domain protein 88 | ||||
| Refseq | NP_565291.2 | 1e-101 | myb domain protein 88 | ||||
| Swissprot | F4IRB4 | 1e-102 | MYB88_ARATH; Transcription factor MYB88 | ||||
| TrEMBL | A0A178VPJ2 | 3e-99 | A0A178VPJ2_ARATH; MYB88 | ||||
| TrEMBL | A0A1P8B2X7 | 1e-100 | A0A1P8B2X7_ARATH; Myb domain protein 88 | ||||
| STRING | AT2G02820.2 | 1e-100 | (Arabidopsis thaliana) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02820.1 | 1e-104 | myb domain protein 88 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.0086s0004.1.p |




