![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.0644s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 115aa MW: 13612.1 Da PI: 8.7932 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 42 | 2.1e-13 | 22 | 77 | 5 | 60 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
+++rr+ +NRe+ArrsR RK+ ++eL v L +eN L+++l++ +++ +++
Araha.0644s0001.1.p 22 RKQRRMLSNRESARRSRMRKQRHLDELWAQVIRLRNENNCLIDKLNRVSETQDSVL 77
79**********************************************99887765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 2.2E-14 | 18 | 82 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.737 | 20 | 83 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 3.46E-12 | 22 | 71 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 2.2E-10 | 22 | 94 | No hit | No description |
| Pfam | PF00170 | 3.1E-11 | 22 | 80 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 5.72E-14 | 23 | 71 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 25 | 40 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MISNNSTSDE DHHQSIVILD ERKQRRMLSN RESARRSRMR KQRHLDELWA QVIRLRNENN 60 CLIDKLNRVS ETQDSVLKEN SKLKEEASDL RQLVCELKSN KNNNNSFSRE FEDN* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 34 | 41 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.0644s0001.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC007178 | 1e-153 | AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence. | |||
| GenBank | CP002685 | 1e-153 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010502422.1 | 7e-71 | PREDICTED: basic leucine zipper 43-like | ||||
| Swissprot | Q9FMC2 | 2e-29 | BZP43_ARATH; Basic leucine zipper 43 | ||||
| TrEMBL | A0A178VS52 | 7e-63 | A0A178VS52_ARATH; BZIP48 | ||||
| TrEMBL | D7LQQ5 | 6e-63 | D7LQQ5_ARALL; Uncharacterized protein | ||||
| TrEMBL | Q8RU59 | 7e-63 | Q8RU59_ARATH; BZIP protein (AtbZIP48) | ||||
| STRING | XP_010502422.1 | 3e-70 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2892 | 24 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G04038.1 | 3e-67 | basic leucine-zipper 48 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.0644s0001.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




