![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.1122s0014.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 161aa MW: 17129 Da PI: 6.1171 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 188.7 | 4e-59 | 20 | 115 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+kyr
Araha.1122s0014.1.p 20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQKYR 109
89**************************************************************************************** PP
NF-YB 92 elegek 97
e+egek
Araha.1122s0014.1.p 110 EVEGEK 115
****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.7E-56 | 15 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.37E-42 | 22 | 126 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.6E-28 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.4E-22 | 53 | 71 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.4E-22 | 72 | 90 | No hit | No description |
| PRINTS | PR00615 | 5.4E-22 | 91 | 109 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MADSDNDSGG HKDGGNASTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF 60 ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKVYLQKYRE VEGEKTTTAG 120 RQGDKEGGGG GGAGSGSGGA PMYGGGMVTT MGHQFSHHFS * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 1e-50 | 14 | 110 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.1122s0014.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK117818 | 0.0 | AK117818.1 Arabidopsis thaliana At4g14540 mRNA for putative CCAAT-binding transcription factor subunit A(CBF-A), complete cds, clone: RAFL18-01-N02. | |||
| GenBank | AL161539 | 0.0 | AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39. | |||
| GenBank | BT003684 | 0.0 | BT003684.1 Arabidopsis thaliana At4g14540 mRNA, complete cds. | |||
| GenBank | CP002687 | 0.0 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| GenBank | Z97336 | 0.0 | Z97336.1 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 1. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_193190.1 | 1e-103 | nuclear factor Y, subunit B3 | ||||
| Swissprot | O23310 | 1e-104 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A178V2P3 | 1e-102 | A0A178V2P3_ARATH; NF-YB3 | ||||
| STRING | AT4G14540.1 | 1e-103 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 4e-99 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.1122s0014.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




