![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.12533s0002.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 129aa MW: 15003.1 Da PI: 8.8325 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 61.3 | 2.5e-19 | 14 | 83 | 2 | 71 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekk 71
F kkly++++d+++++++sws+ng+sf++++e ef ++vLp++ +++a F+R L gFkk++++e +
Araha.12533s0002.1.p 14 FRKKLYKMVDDPSTNSIVSWSDNGKSFIIWNEPEFCRDVLPRFSHYKEMAPFIRRLGNMGFKKIESKELE 83
889***************************************9999******************998844 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 7.1E-24 | 7 | 95 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 4.2E-21 | 10 | 106 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.58E-22 | 11 | 95 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.8E-10 | 14 | 37 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.3E-18 | 14 | 95 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-10 | 52 | 64 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-10 | 65 | 77 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MDRDNNHKDR CLYFRKKLYK MVDDPSTNSI VSWSDNGKSF IIWNEPEFCR DVLPRFSHYK 60 EMAPFIRRLG NMGFKKIESK ELEYGSDDFV RGHPEPDLSP EAVRARLKEL ALASRKELCG 120 SKTLRSDV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5w_B | 1e-15 | 14 | 95 | 4 | 89 | Putative transcription factor |
| 5d5x_B | 1e-15 | 14 | 95 | 4 | 89 | Putative transcription factor |
| 5d5x_E | 1e-15 | 14 | 95 | 4 | 89 | Putative transcription factor |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.12533s0002.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB010695 | 1e-40 | AB010695.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDK4. | |||
| GenBank | CP002688 | 1e-40 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001340391.1 | 1e-26 | heat stress transcription factor 29 | ||||
| Refseq | XP_028191561.1 | 1e-26 | heat stress transcription factor A-4a-like | ||||
| TrEMBL | D7MU83 | 6e-55 | D7MU83_ARALL; Uncharacterized protein | ||||
| STRING | Bostr.3359s0057.1.p | 7e-57 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13231 | 11 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18870.1 | 1e-23 | HSF family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.12533s0002.1.p |




