![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.12597s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 6927.02 Da PI: 10.6235 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92 | 2.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvtfskRr g++KKA ELSvLCda+va i+fs++g+lyeyss
Araha.12597s0001.1.p 9 KKIENVTSRQVTFSKRRSGLFKKARELSVLCDAQVAAIVFSQSGRLYEYSS 59
78***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.272 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.7E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.30E-35 | 3 | 60 | No hit | No description |
| SuperFamily | SSF55455 | 8.24E-29 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.2E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KARELSVLCD AQVAAIVFSQ SGRLYEYSSS 60 E* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6bz1_A | 3e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_B | 3e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_C | 3e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_D | 3e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6c9l_A | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-17 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.12597s0001.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB025623 | 7e-71 | AB025623.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJM18. | |||
| GenBank | CP002688 | 7e-71 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010442695.1 | 3e-34 | PREDICTED: MADS-box protein AGL71-like isoform X2 | ||||
| Refseq | XP_010442697.1 | 3e-34 | PREDICTED: MADS-box protein AGL71-like isoform X2 | ||||
| Refseq | XP_019087845.1 | 4e-34 | PREDICTED: MADS-box protein AGL71-like isoform X1 | ||||
| Swissprot | Q9LT93 | 2e-34 | AGL71_ARATH; MADS-box protein AGL71 | ||||
| TrEMBL | D7MRJ8 | 2e-32 | D7MRJ8_ARALL; Predicted protein | ||||
| STRING | XP_010442695.1 | 1e-33 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51870.2 | 4e-37 | AGAMOUS-like 71 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.12597s0001.1.p |




