PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araha.15608s0005.1.p

Organism

Arabidopsis halleri

Taxonomic ID

81970

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 110aa MW: 12482.1 Da PI: 10.616

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araha.15608s0005.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	27.7	6.3e-09	3	37	13	47
HHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 13 vdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + + k++G+g+W++I+r + +Rt+ q+ s+ qky Araha.15608s0005.1.p 3 LIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 37 55789*****************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00167	1.34E-5	1	38	No hit	No description
SuperFamily	SSF46689	5.11E-10	1	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.365	1	42	IPR017930	Myb domain
TIGRFAMs	TIGR01557	5.8E-11	2	41	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	1.4E-5	3	37	IPR009057	Homeodomain-like
Pfam	PF00249	9.6E-7	5	37	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
LFLIGLKRYG KGDWRSISRN VVVTRTPTQV ASHAQKYFLR QNSVKKERKR SSIHDITTVD 60 TTLAMPGSTM DWTGQHESPV QAQPQQQIMS EFGQQLTTPG HFEDFGFRM*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269\|PubMed:26243618}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araha.15608s0005.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:26243618}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY088362	1e-119	AY088362.1 Arabidopsis thaliana clone 6170 mRNA, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002873168.1	3e-75	transcription factor DIVARICATA
Swissprot	Q9FNN6	2e-28	SRM1_ARATH; Transcription factor SRM1
TrEMBL	D7LXM5	7e-74	D7LXM5_ARALL; Uncharacterized protein
STRING	scaffold_600421.1	1e-74	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5127	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	3e-71	MYB family protein

Link Out ? help Back to Top
Phytozome	Araha.15608s0005.1.p

Publications ? help Back to Top
Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Chen YS, et al. Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis. Plant Mol. Biol., 2017. 93(3): p. 299-311 [PMID:27866313]