![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.15626s0002.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 130aa MW: 14769.1 Da PI: 10.5865 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 53.5 | 5e-17 | 44 | 103 | 2 | 61 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
++ +r+rr++kNRe+A rsR+RK+a++ eLe +++Le+eN+ L ke+ee +ke ++ +
Araha.15626s0002.1.p 44 AAAQRQRRMIKNRESAARSRERKQAYQVELEALAAKLEEENELLSKEIEEKRKERYQKLM 103
5789**********************************************9999987765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 3.1E-14 | 41 | 98 | No hit | No description |
| SMART | SM00338 | 4.4E-12 | 43 | 107 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 5.6E-16 | 44 | 104 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.277 | 45 | 97 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 1.44E-13 | 47 | 93 | No hit | No description |
| SuperFamily | SSF57959 | 3.44E-11 | 47 | 99 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 50 | 65 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MIDKVEGSIV AFGNGLDVYG GGGGGSGGVR GKRARVMVEP LDKAAAQRQR RMIKNRESAA 60 RSRERKQAYQ VELEALAAKL EEENELLSKE IEEKRKERYQ KLMEFVIPVV EKPKQQPLRF 120 LRRIRSLEW* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.15626s0002.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY086457 | 1e-157 | AY086457.1 Arabidopsis thaliana clone 25211 mRNA, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_199221.1 | 1e-76 | Basic-leucine zipper (bZIP) transcription factor family protein | ||||
| Swissprot | P42777 | 9e-45 | GBF4_ARATH; G-box-binding factor 4 | ||||
| TrEMBL | A0A178UQ19 | 3e-75 | A0A178UQ19_ARATH; Uncharacterized protein | ||||
| TrEMBL | Q8LCQ7 | 3e-75 | Q8LCQ7_ARATH; Uncharacterized protein | ||||
| TrEMBL | Q9FNB9 | 3e-75 | Q9FNB9_ARATH; Basic leucine zipper transcription factor | ||||
| STRING | AT5G44080.1 | 5e-76 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3852 | 28 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G44080.1 | 3e-43 | bZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.15626s0002.1.p |




