![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.18685s0003.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 149aa MW: 16171 Da PI: 9.7384 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 120.4 | 6.4e-38 | 26 | 86 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGg +rk+ k+s
Araha.18685s0003.1.p 26 QQEQLPCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKSSKRS 86
57899***************************************************98875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-35 | 2 | 74 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 2.8E-33 | 28 | 84 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.64 | 30 | 84 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 32 | 68 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000976 | Molecular Function | transcription regulatory region sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 149 aa Download sequence Send to blast |
MPSEFSESRR IPKLSHGGDV AIPTDQQEQL PCPRCESTNT KFCYYNNYNF SQPRHFCKSC 60 RRYWTHGGTL RDIPVGGVSR KSSKRSRTCS SAATTTVVGS RNFPLQATPV LFPQSSSNGV 120 STTSKGNASS LYGGQESKVG FVSGDYLA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00593 | DAP | Transfer from AT5G66940 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.18685s0003.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB026640 | 1e-163 | AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10. | |||
| GenBank | AB493817 | 1e-163 | AB493817.1 Arabidopsis thaliana At5g66940 gene for hypothetical protein, partial cds, clone: RAAt5g66940. | |||
| GenBank | BT029523 | 1e-163 | BT029523.1 Arabidopsis thaliana At5g66940 mRNA, complete cds. | |||
| GenBank | CP002688 | 1e-163 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002865040.2 | 3e-92 | dof zinc finger protein DOF5.8 | ||||
| Swissprot | Q9FGD6 | 1e-85 | DOF58_ARATH; Dof zinc finger protein DOF5.8 | ||||
| TrEMBL | D7MLD9 | 8e-91 | D7MLD9_ARALL; Dof-type zinc finger domain-containing protein | ||||
| STRING | scaffold_803422.1 | 1e-91 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2286 | 28 | 74 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66940.1 | 2e-67 | Dof family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.18685s0003.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




