![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.18863s0006.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 180aa MW: 19966.4 Da PI: 11.019 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 45 | 2.6e-14 | 27 | 71 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE+ l++ + + G+g+W+ I+r + k+Rt+ q+ s+ qky
Araha.18863s0006.1.p 27 PWTEEEHRLFLTGLHIVGKGDWRGISRNFVKTRTPTQVASHAQKY 71
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 18.643 | 20 | 76 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 4.09E-17 | 22 | 76 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.0E-15 | 23 | 74 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 7.3E-11 | 24 | 74 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-10 | 26 | 71 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.2E-11 | 27 | 71 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.94E-10 | 27 | 72 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009723 | Biological Process | response to ethylene | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0031540 | Biological Process | regulation of anthocyanin biosynthetic process | ||||
| GO:0046686 | Biological Process | response to cadmium ion | ||||
| GO:0080167 | Biological Process | response to karrikin | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 180 aa Download sequence Send to blast |
PADDGGYASD DVVHASGRNR ERKRGTPWTE EEHRLFLTGL HIVGKGDWRG ISRNFVKTRT 60 PTQVASHAQK YFLRRTNQNR RRRRSSLFDI TPDSFTGSPK EENLLHTPLD GSKLIRPVPI 120 PIPIPPSRKM ADLNLNQKTQ PTTEMFPLSA SSNEQKARGS RASGFEAMSS NGDSIMGVA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.18863s0006.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK227711 | 1e-157 | AK227711.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-29-L19. | |||
| GenBank | AY519509 | 1e-157 | AY519509.1 Arabidopsis thaliana MYB transcription factor (At1g70000) mRNA, complete cds. | |||
| GenBank | BT006413 | 1e-157 | BT006413.1 Arabidopsis thaliana At1g70000 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020891771.1 | 1e-101 | transcription factor KUA1 | ||||
| Swissprot | Q9LVS0 | 3e-42 | KUA1_ARATH; Transcription factor KUA1 | ||||
| TrEMBL | D7KXL6 | 1e-100 | D7KXL6_ARALL; Uncharacterized protein | ||||
| STRING | fgenesh2_kg.2__1257__AT1G70000.1 | 1e-101 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM9791 | 26 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G70000.2 | 5e-90 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.18863s0006.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




