![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.19854s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 104aa MW: 11940.5 Da PI: 8.8802 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 67.3 | 2.7e-21 | 29 | 76 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd+ll+++v+ +G g+W+t+a++ g++R++k+c++rw +yl
Araha.19854s0001.1.p 29 KGPWTLEEDKLLAEYVTSHGEGRWSTVAKCAGLNRSGKSCRLRWVNYL 76
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-24 | 21 | 79 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 23.285 | 24 | 80 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.0E-16 | 28 | 78 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.9E-19 | 29 | 76 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.68E-23 | 30 | 103 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.22E-12 | 31 | 76 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.2E-7 | 80 | 103 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MLDWGVQGHH QKHDHDLYQQ QHQQQGCRKG PWTLEEDKLL AEYVTSHGEG RWSTVAKCAG 60 LNRSGKSCRL RWVNYLRPGL KRGQITPQEE GIILELHSLW GNK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-13 | 29 | 103 | 27 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.19854s0001.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF371980 | 1e-159 | AF371980.2 Arabidopsis thaliana putative transcription factor MYB121 (MYB121) mRNA, complete cds. | |||
| GenBank | AY519593 | 1e-159 | AY519593.1 Arabidopsis thaliana MYB transcription factor (At3g30210) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_189640.1 | 8e-71 | myb domain protein 121 | ||||
| Swissprot | Q10MB4 | 6e-34 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| Swissprot | Q9C9G7 | 5e-34 | MYB62_ARATH; Transcription factor MYB62 | ||||
| TrEMBL | Q9LRU5 | 2e-69 | Q9LRU5_ARATH; MYB transcription factor | ||||
| STRING | AT3G30210.1 | 3e-70 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30210.1 | 4e-58 | myb domain protein 121 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.19854s0001.1.p |




