![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.24710s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 107aa MW: 13005.6 Da PI: 9.9931 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 24.3 | 7.2e-08 | 33 | 72 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++++E++l+ + ++ G + W++Ia +++ gR ++++ +w
Araha.24710s0001.1.p 33 MSEQEEDLIFRMYRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72
799**************99.*********.***********5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 6.3E-6 | 29 | 77 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.06E-5 | 32 | 71 | No hit | No description |
| Pfam | PF00249 | 3.0E-7 | 33 | 72 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-9 | 34 | 72 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.191 | 34 | 71 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 3.84E-7 | 34 | 72 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MDNTDRRRRR KQHKIALHDS EEVSSIEWEF INMSEQEEDL IFRMYRLVGD RWDLIAGRVP 60 GRQPEEIERY WIMRNSEGFA EKRRQLHSSS HKHTKPHRPR FSIYPS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.24710s0001.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY161286 | 1e-156 | AY161286.1 Arabidopsis thaliana TRIPTYCHON mRNA, complete cds. | |||
| GenBank | AY519523 | 1e-156 | AY519523.1 Arabidopsis thaliana MYB transcription factor (At5g53200) mRNA, complete cds. | |||
| GenBank | BT024672 | 1e-156 | BT024672.1 Arabidopsis thaliana unknown protein (At5g53200) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_200132.2 | 2e-72 | Homeodomain-like superfamily protein | ||||
| Swissprot | Q8GV05 | 2e-73 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A178UFU9 | 4e-71 | A0A178UFU9_ARATH; TRY | ||||
| STRING | AT5G53200.1 | 7e-72 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 6e-76 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.24710s0001.1.p |




