![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.25327s0008.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 104aa MW: 12131.8 Da PI: 9.5042 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 108.6 | 3.2e-34 | 21 | 70 | 2 | 51 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPv 51
++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+
Araha.25327s0008.1.p 21 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNIST 70
5789*******************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-25 | 13 | 71 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.4E-29 | 23 | 75 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 25.62 | 25 | 79 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 27 | 63 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MQDPAAYYQT MMAKQQPQFA EQEQLKCPRC DSPNTKFCYY NNYNLSQPRH FCKSCRRYWT 60 KGGALRNIST SLTHKDTTNK DTTFKRSKTN LPMQSLLVLN EFC* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.25327s0008.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB017565 | 8e-75 | AB017565.1 Arabidopsis thaliana adof2 mRNA for Dof zinc finger protein, complete cds. | |||
| GenBank | AB023045 | 8e-75 | AB023045.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXL8. | |||
| GenBank | AY045847 | 8e-75 | AY045847.1 Arabidopsis thaliana putative Dof zinc finger protein (At3g21270) mRNA, complete cds. | |||
| GenBank | AY150391 | 8e-75 | AY150391.1 Arabidopsis thaliana Dof zinc finger protein (At3g21270) mRNA, complete cds. | |||
| GenBank | CP002686 | 8e-75 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002883295.1 | 5e-46 | dof zinc finger protein DOF3.1 | ||||
| Swissprot | O82155 | 7e-36 | DOF17_ARATH; Dof zinc finger protein DOF1.7 | ||||
| TrEMBL | D7L0R0 | 1e-44 | D7L0R0_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_302540.1 | 2e-45 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1269 | 28 | 96 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G51700.1 | 3e-38 | DOF zinc finger protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.25327s0008.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




